MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000054

Record overview

MITO ID	MT000054
Gene ID	514
Species	Homo sapiens (Human)
Gene Name	ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Gene Symbol	ATP5E
Synonyms	ATPE; MC5DN3;
Alternate names	ATP synthase subunit epsilon, mitochondrial; F(0)F(1)-ATPase; mitochondrial ATPase; H(+)-transporting two-sector ATPase; mitochondrial ATP synthase epsilon chain;
Chromosome	20
Map Location	20q13.32
Summary	This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. Read-through transcripts that include exons from this gene are expressed from the upstream gene SLMO2.[provided by RefSeq, Mar 2011]
Orthologs	View orthologs and multiple alignments for ATP5E

Proteins

ATP synthase subunit epsilon, mitochondrial

Refseq ID:	NP_008817
Protein GI:	5901896
UniProt ID:	P56381
mRNA ID:	NM_006886
Length:	51
RefSeq Status:

`MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE`