MitoProteome Database

MT000056

Record overview

MITO IDMT000056
Gene ID516
SpeciesHomo sapiens (Human)
Gene NameATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Gene SymbolATP5G1
SynonymsATP5A; ATP5G;
Alternate namesATP synthase F(0) complex subunit C1, mitochondrial; ATPase protein 9; ATPase subunit 9; ATPase subunit C; ATP synthase proteolipid P1; mitochondrial ATP synthase, subunit 9, isoform 1; mitochondrial ATP synthase, subunit C, isoform 1; ATP synthase lipid-binding protein, mitochondrial; ATP synthase proton-transporting mitochondrial F(0) complex subunit C1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1;
Chromosome17
Map Location17q21.32
SummaryThis gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for ATP5G1

Proteins

ATP synthase F(0) complex subunit C1, mitochondrial precursor
Refseq ID:NP_005166
Protein GI:4885081
UniProt ID:P05496
mRNA ID:NM_005175
Length:136
RefSeq Status:
MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARN
PSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
 
N
transit_peptide: 1..61
calculated_mol_wt: 6687
peptide sequence: 
MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSR

mat_peptide: 62..136
product: ATP synthase F(0) complex subunit C1, mitochondrial
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

transit_peptide: 1..61
calculated_mol_wt: 6687
peptide sequence: 
MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSR

mat_peptide: 62..136
product: ATP synthase F(0) complex subunit C1, mitochondrial
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
 
ATP synthase F(0) complex subunit C1, mitochondrial precursor
Refseq ID:NP_001002027
Protein GI:50659069
UniProt ID:P05496
mRNA ID:NM_001002027
Length:136
RefSeq Status:
Protein sequence is identical to GI:4885081 (mRNA isoform)
 
N
transit_peptide: 1..61
calculated_mol_wt: 6687
peptide sequence: 
MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSR

mat_peptide: 62..136
product: ATP synthase F(0) complex subunit C1, mitochondrial
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM