MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000059

Record overview

MITO ID	MT000059
Gene ID	521
Species	Homo sapiens (Human)
Gene Name	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E
Gene Symbol	ATP5I
Synonyms	ATP5K;
Alternate names	ATP synthase subunit e, mitochondrial; ATPase subunit e; ATP synthase e chain, mitochondrial; F1F0-ATP synthase, murine e subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E;
Chromosome	4
Map Location	4p16.3
Summary	Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the e subunit of the Fo complex. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010]
Orthologs	View orthologs and multiple alignments for ATP5I

Proteins

ATP synthase subunit e, mitochondrial

Refseq ID:	NP_009031
Protein GI:	6005717
UniProt ID:	P56385
mRNA ID:	NM_007100
Length:	69
RefSeq Status:

`MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK`