MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000079

Record overview

MITO IDMT000079
Gene ID599
SpeciesHomo sapiens (Human)
Gene NameBCL2-like 2
Gene SymbolBCL2L2
SynonymsBCLW; BCL-W; PPP1R51; BCL2-L-2;
Alternate namesbcl-2-like protein 2; apoptosis regulator BCL-W; protein phosphatase 1, regulatory subunit 51;
Chromosome14
Map Location14q11.2-q12
SummaryThis gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. [provided by RefSeq, Dec 2010]
OrthologsView orthologs and multiple alignments for BCL2L2

Proteins

bcl-2-like protein 2
Refseq ID:NP_001186768
Protein GI:315360668
UniProt ID:Q92843
mRNA ID:NM_001199839
Length:193
RefSeq Status:
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
 
bcl-2-like protein 2
Refseq ID:NP_004041
Protein GI:4757842
UniProt ID:Q92843
mRNA ID:NM_004050
Length:193
RefSeq Status:
Protein sequence is identical to GI:315360668 (mRNA isoform)