MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000087

Record overview

MITO ID	MT000087
Gene ID	664
Species	Homo sapiens (Human)
Gene Name	BCL2/adenovirus E1B 19kDa interacting protein 3
Gene Symbol	BNIP3
Synonyms	NIP3;
Alternate names	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3;
Chromosome	10
Map Location	10q26.3
Summary	This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methylation. [provided by RefSeq, Dec 2014]
Orthologs	View orthologs and multiple alignments for BNIP3

Proteins

BCL2/adenovirus E1B 19 kDa protein-interacting protein 3

Refseq ID:	NP_004043
Protein GI:	734703979
UniProt ID:
mRNA ID:	NM_004052
Length:	259
RefSeq Status:

`MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPAS VSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFK HPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF`