MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000089

Record overview

MITO ID	MT000089
Gene ID	666
Species	Homo sapiens (Human)
Gene Name	BCL2-related ovarian killer
Gene Symbol	BOK
Synonyms	BOKL; BCL2L9;
Alternate names	bcl-2-related ovarian killer protein; hBOK; bcl2-L-9; bcl-2-like protein 9;
Chromosome	2
Map Location	2q37.3
Summary	The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family. [provided by RefSeq, Sep 2011]
Orthologs	View orthologs and multiple alignments for BOK

Proteins

bcl-2-related ovarian killer protein

Refseq ID:	NP_115904
Protein GI:	14210524
UniProt ID:	Q9UMX3
mRNA ID:	NM_032515
Length:	212
RefSeq Status:

`MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEP VVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRF LKAAFFVLLPER`