MitoProteome Database

MT000095

Record overview

MITO ID	MT000095
Gene ID	708
Species	Homo sapiens (Human)
Gene Name	complement component 1, q subcomponent binding protein
Gene Symbol	C1QBP
Synonyms	p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R;
Alternate names	complement component 1 Q subcomponent-binding protein, mitochondrial; p33; glycoprotein gC1qBP; hyaluronan-binding protein 1; ASF/SF2-associated protein p32; mitochondrial matrix protein p32; C1q globular domain-binding protein; splicing factor SF2-associated protein;
Chromosome	17
Map Location	17p13.3
Summary	The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for C1QBP

Proteins

complement component 1 Q subcomponent-binding protein, mitochondrial precursor

Refseq ID:	NP_001203
Protein GI:	4502491
UniProt ID:	Q07021
mRNA ID:	NM_001212
Length:	282
RefSeq Status:

`MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHK TLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE SDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ`

N
transit_peptide: 1..73
calculated_mol_wt: 7597
peptide sequence: 
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGS

mat_peptide: 74..282
product: complement component 1 Q subcomponent-binding protein, mitochondrial
calculated_mol_wt: 23783
peptide sequence: 
LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVI
KNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLE
DLKSFVKSQ