MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000110

Record overview

MITO ID	MT000110
Gene ID	858
Species	Homo sapiens (Human)
Gene Name	caveolin 2
Gene Symbol	CAV2
Synonyms	CAV;
Alternate names	caveolin-2; caveolae protein, 20-kD; caveolin 2 isoform a and b;
Chromosome	7
Map Location	7q31.1
Summary	The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462). [provided by RefSeq, May 2011]
Orthologs	View orthologs and multiple alignments for CAV2

Proteins

caveolin-2 isoform a

Refseq ID:	NP_001224
Protein GI:	4557413
UniProt ID:	P51636
mRNA ID:	NM_001233
Length:	162
RefSeq Status:

caveolin-2 isoform b
`MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIA GILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD`

Refseq ID:	NP_001193676
Protein GI:	332164664
UniProt ID:	P51636
mRNA ID:	NM_001206747
Length:	149
RefSeq Status:

caveolin-2 isoform c
`MDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIW ILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD`

Refseq ID:	NP_937855
Protein GI:	38176292
UniProt ID:	P51636
mRNA ID:	NM_198212
Length:	112
RefSeq Status:

caveolin-2 isoform d
`MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKDFNAFCKDLPNGSAFSADNMEECDRCYHCSIVYERRTMLLFCQPATEPGL NTWTPGLEIGIL`

Refseq ID:	NP_001193677
Protein GI:	332164666
UniProt ID:	P51636
mRNA ID:	NM_001206748
Length:	79
RefSeq Status:

`MYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD`