MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000118

Record overview

MITO ID	MT000118
Gene ID	1149
Species	Homo sapiens (Human)
Gene Name	cell death-inducing DFFA-like effector a
Gene Symbol	CIDEA
Synonyms	CIDE-A;
Alternate names	cell death activator CIDE-A;
Chromosome	18
Map Location	18p11.21
Summary	This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Alternatively spliced transcripts have been identified. [provided by RefSeq, Aug 2010]
Orthologs	View orthologs and multiple alignments for CIDEA

Proteins

cell death activator CIDE-A isoform 1

Refseq ID:	NP_001270
Protein GI:	4557465
UniProt ID:	O60543
mRNA ID:	NM_001279
Length:	219
RefSeq Status:

`MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFM ILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLD DKEERPSLRSQAKGRFTCG`