MitoProteome Database

MT000130

Record overview

MITO ID	MT000130
Gene ID	1329
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit Vb
Gene Symbol	COX5B
Synonyms	COXVB;
Alternate names	cytochrome c oxidase subunit 5B, mitochondrial; cytochrome c oxidase polypeptide VB, mitochondrial;
Chromosome	2
Map Location	2q11.2
Summary	Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for COX5B

Proteins

cytochrome c oxidase subunit 5B, mitochondrial precursor

Refseq ID:	NP_001853
Protein GI:	17017988
UniProt ID:	P10606
mRNA ID:	NM_001862
Length:	129
RefSeq Status:

`MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSV VWFWLHKGEAQRCPRCGAHYKLVPQQLAH`

N
transit_peptide: 1..31
calculated_mol_wt: 3101
peptide sequence: 
MASRLLRGAGTLAAQALRARGPSGAAAMRSM

mat_peptide: 32..129
product: cytochrome c oxidase subunit 5B, mitochondrial
calculated_mol_wt: 10613
peptide sequence: 
ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH