MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000132

Record overview

MITO IDMT000132
Gene ID1339
SpeciesHomo sapiens (Human)
Gene Namecytochrome c oxidase subunit VIa polypeptide 2
Gene SymbolCOX6A2
SynonymsCOX6AH; COXVIAH;
Alternate namescytochrome c oxidase subunit 6A2, mitochondrial; COX VIa-M; cytochrome c oxidase subunit VIA-muscle; cytochrome c oxidase polypeptide VIa-heart;
Chromosome16
Map Location16p11.12
SummaryCytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for COX6A2

Proteins

cytochrome c oxidase subunit 6A2, mitochondrial precursor
Refseq ID:NP_005196
Protein GI:4885149
UniProt ID:Q02221
mRNA ID:NM_005205
Length:97
RefSeq Status:
MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
 
N
transit_peptide: 1..12
inference: non-experimental evidence, no additional details recorded
note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (Q02221.2)
calculated_mol_wt: 1338
peptide sequence: 
MALPLRPLTRGL

mat_peptide: 13..97
product: Cytochrome c oxidase subunit 6A2, mitochondrial
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (Q02221.2)
calculated_mol_wt: 9496
peptide sequence: 
ASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP