MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000133

Record overview

MITO ID	MT000133
Gene ID	1340
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
Gene Symbol	COX6B1
Synonyms	COXG; COX6B; COXVIb1;
Alternate names	cytochrome c oxidase subunit 6B1; COX VIb-1;
Chromosome	19
Map Location	19q13.1
Summary	Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq, Jan 2010]
Orthologs	View orthologs and multiple alignments for COX6B1

Proteins

cytochrome c oxidase subunit 6B1

Refseq ID:	NP_001854
Protein GI:	4502985
UniProt ID:	P14854
mRNA ID:	NM_001863
Length:	86
RefSeq Status:

`MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI`