MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000134

Record overview

MITO ID	MT000134
Gene ID	1345
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit VIc
Gene Symbol	COX6C
Alternate names	cytochrome c oxidase subunit 6C; cytochrome c oxidase polypeptide VIc; cytochrome c oxidase subunit VIc preprotein;
Chromosome	8
Map Location	8q22.2
Summary	Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12. [provided by RefSeq, Jul 2010]
Orthologs	View orthologs and multiple alignments for COX6C

Proteins

cytochrome c oxidase subunit 6C proprotein

Refseq ID:	NP_004365
Protein GI:	4758040
UniProt ID:	P09669
mRNA ID:	NM_004374
Length:	75
RefSeq Status:

`MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK`