MitoProteome Database

MT000135

Record overview

MITO ID	MT000135
Gene ID	1346
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit VIIa polypeptide 1 (muscle)
Gene Symbol	COX7A1
Synonyms	COX7A; COX7AH; COX7AM;
Alternate names	cytochrome c oxidase subunit 7A1, mitochondrial; cytochrome c oxidase subunit VIIa-H; cytochrome c oxidase subunit VIIa-M; cytochrome c oxidase subunit VIIa-heart; cytochrome c oxidase subunit VIIa-muscle; cytochrome c oxidase subunit VIIa heart/muscle isoform;
Chromosome	19
Map Location	19q13.1
Summary	Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for COX7A1

Proteins

cytochrome c oxidase subunit 7A1, mitochondrial precursor

Refseq ID:	NP_001855
Protein GI:	4502987
UniProt ID:	P24310
mRNA ID:	NM_001864
Length:	79
RefSeq Status:

`MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN`

N
transit_peptide: 1..21
calculated_mol_wt: 2393
peptide sequence: 
MQALRVSQALIRSFSSTARNR

mat_peptide: 22..79
product: cytochrome c oxidase subunit 7A1, mitochondrial
calculated_mol_wt: 6743
peptide sequence: 
FQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN