MitoProteome Database

MT000136

Record overview

MITO ID	MT000136
Gene ID	1347
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit VIIa polypeptide 2 (liver)
Gene Symbol	COX7A2
Synonyms	VIIAL; COX7AL; COX7AL1; COXVIIAL; COXVIIa-L;
Alternate names	cytochrome c oxidase subunit 7A2, mitochondrial; cytochrome c oxidase subunit VIIaL; cytochrome c oxidase subunit VIIa-L; hepatic cytochrome-c oxidase chain VIIa; cytochrome c oxidase subunit VIIa-liver/heart; cytochrome c oxidase polypeptide VIIa-liver/heart; cytochrome c oxidase polypeptide 7A2, mitochondrial;
Chromosome	6
Map Location	6q12
Summary	Cytochrome c oxidase, the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of three catalytic subunits encoded by mitochondrial genes, and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, while the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (liver isoform) of subunit VIIa, with this polypeptide being present in both muscle and non-muscle tissues. In addition to polypeptide 2, subunit VIIa includes polypeptide 1 (muscle isoform), which is present only in muscle tissues, and a related protein, which is present in all tissues. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4 and 14. [provided by RefSeq, Oct 2009]
Orthologs	View orthologs and multiple alignments for COX7A2

Proteins

cytochrome c oxidase subunit 7A2, mitochondrial precursor

Refseq ID:	NP_001856
Protein GI:	262118227
UniProt ID:	P14406
mRNA ID:	NM_001865
Length:	115
RefSeq Status:

`MHTQDSEVVPVPAWPFSLVVFSCGGCWSVTAKMLRNLLALRQIGQRTISTASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY AIYELAVASFPKKQE`

N
transit_peptide: 1..55
calculated_mol_wt: 6140
peptide sequence: 
MHTQDSEVVPVPAWPFSLVVFSCGGCWSVTAKMLRNLLALRQIGQRTISTASRRH

mat_peptide: 56..115
product: cytochrome c oxidase subunit 7A2, mitochondrial
calculated_mol_wt: 6722
peptide sequence: 
FKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE