MitoProteome Database

MT000138

Record overview

MITO ID	MT000138
Gene ID	1349
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit VIIb
Gene Symbol	COX7B
Synonyms	APLCC;
Alternate names	cytochrome c oxidase subunit 7B, mitochondrial; cytochrome-c oxidase chain VIIb; cytochrome c oxidase polypeptide VIIb;
Chromosome	X
Map Location	Xq21.1
Summary	Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22. [provided by RefSeq, Jun 2011]
Orthologs	View orthologs and multiple alignments for COX7B

Proteins

cytochrome c oxidase subunit 7B, mitochondrial precursor

Refseq ID:	NP_001857
Protein GI:	4502991
UniProt ID:	P24311
mRNA ID:	NM_001866
Length:	80
RefSeq Status:

`MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ`

N
transit_peptide: 1..24
calculated_mol_wt: 2816
peptide sequence: 
MFPLVKSALNRLQVRSIQQTMARQ

mat_peptide: 25..80
product: cytochrome c oxidase subunit 7B, mitochondrial
calculated_mol_wt: 6362
peptide sequence: 
SHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ