MitoProteome Database

MT000139

Record overview

MITO ID	MT000139
Gene ID	1350
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit VIIc
Gene Symbol	COX7C
Alternate names	cytochrome c oxidase subunit 7C, mitochondrial; cytochrome-c oxidase chain VIIc; cytochrome c oxidase polypeptide VIIc;
Chromosome	5
Map Location	5q14
Summary	Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIc, which shares 87% and 85% amino acid sequence identity with mouse and bovine COX VIIc, respectively, and is found in all tissues. A pseudogene COX7CP1 has been found on chromosome 13. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for COX7C

Proteins

cytochrome c oxidase subunit 7C, mitochondrial precursor

Refseq ID:	NP_001858
Protein GI:	4502993
UniProt ID:	P15954
mRNA ID:	NM_001867
Length:	63
RefSeq Status:

`MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT`

N
transit_peptide: 1..16
calculated_mol_wt: 1907
peptide sequence: 
MLGQSIRRFTTSVVRR

mat_peptide: 17..63
product: cytochrome c oxidase subunit 7C, mitochondrial
calculated_mol_wt: 5356
peptide sequence: 
SHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT