MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000140

Record overview

MITO ID	MT000140
Gene ID	1351
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit VIIIA (ubiquitous)
Gene Symbol	COX8A
Synonyms	COX; COX8; VIII; COX8L; COX8-2; VIII-L;
Alternate names	cytochrome c oxidase subunit 8A, mitochondrial; cytochrome c oxidase subunit 8-2; cytochrome c oxidase subunit VIII; cytochrome c oxidase subunit 8A (ubiquitous); cytochrome c oxidase polypeptide VIII-liver/heart;
Chromosome	11
Map Location	11q12-q13
Summary	The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for COX8A

Proteins

cytochrome c oxidase subunit 8A, mitochondrial

Refseq ID:	NP_004065
Protein GI:	4758044
UniProt ID:	P10176
mRNA ID:	NM_004074
Length:	69
RefSeq Status:

`MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE`