MitoProteome Database

MT000143

Record overview

MITO ID	MT000143
Gene ID	1355
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase assembly homolog 15 (yeast)
Gene Symbol	COX15
Synonyms	CEMCOX2;
Alternate names	cytochrome c oxidase assembly protein COX15 homolog; cytochrome c oxidase subunit 15; COX15 homolog, cytochrome c oxidase assembly protein;
Chromosome	10
Map Location	10q24
Summary	Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for COX15

Proteins

cytochrome c oxidase assembly protein COX15 homolog isoform 1

Refseq ID:	NP_510870
Protein GI:	17921985
UniProt ID:	Q7KZN9
mRNA ID:	NM_078470
Length:	410
RefSeq Status:

MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSLPSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMV
DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWY
MVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESW
IPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLPRRTKMAAVTLLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALW
LMNELRRVPK

cytochrome c oxidase assembly protein COX15 homolog isoform 2

Refseq ID:	NP_004367
Protein GI:	17921987
UniProt ID:	Q7KZN9
mRNA ID:	NM_004376
Length:	388
RefSeq Status:

`MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSLPSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMV DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWY MVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESW IPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLPRRTKMAAVTLLALAYTQGPVLFNFTFKISDLDEGIRNI`