MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000667

Record overview

MITO ID	MT000667
Gene ID	8655
Species	Homo sapiens (Human)
Gene Name	dynein, light chain, LC8-type 1
Gene Symbol	DYNLL1
Synonyms	LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1;
Alternate names	dynein light chain 1, cytoplasmic; 8 kDa dynein light chain; cytoplasmic dynein light polypeptide; dynein, cytoplasmic, light polypeptide 1; protein inhibitor of neuronal nitric oxide synthase;
Chromosome	12
Map Location	12q24.23
Summary	Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for DYNLL1

Proteins

dynein light chain 1, cytoplasmic

Refseq ID:	NP_003737
Protein GI:	4505813
UniProt ID:	P63167
mRNA ID:	NM_003746
Length:	89
RefSeq Status:

dynein light chain 1, cytoplasmic
`MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG`

Refseq ID:	NP_001032584
Protein GI:	83267868
UniProt ID:	P63167
mRNA ID:	NM_001037495
Length:	89
RefSeq Status:

dynein light chain 1, cytoplasmic
Protein sequence is identical to GI:4505813 (mRNA isoform)

Refseq ID:	NP_001032583
Protein GI:	83267866
UniProt ID:	P63167
mRNA ID:	NM_001037494
Length:	89
RefSeq Status:

Protein sequence is identical to GI:4505813 (mRNA isoform)