MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000699

Record overview

MITO ID	MT000699
Gene ID	9167
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit VIIa polypeptide 2 like
Gene Symbol	COX7A2L
Synonyms	EB1; SIG81; COX7AR; COX7RP;
Alternate names	cytochrome c oxidase subunit 7A-related protein, mitochondrial; COX7a-related protein; estrogen receptor binding CpG island; cytochrome c oxidase subunit VII-related protein; cytochrome c oxidase subunit VIIa-related protein;
Chromosome	2
Map Location	2p21
Summary	Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for COX7A2L

Proteins

cytochrome c oxidase subunit 7A-related protein, mitochondrial

Refseq ID:	NP_004709
Protein GI:	18105037
UniProt ID:	O14548
mRNA ID:	NM_004718
Length:	114
RefSeq Status:

`MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIY CLIALYMASQPKNK`