MitoProteome Database

MT000705

Record overview

MITO ID	MT000705
Gene ID	9377
Species	Homo sapiens (Human)
Gene Name	cytochrome c oxidase subunit Va
Gene Symbol	COX5A
Synonyms	VA; COX; COX-VA;
Alternate names	cytochrome c oxidase subunit 5A, mitochondrial; cytochrome c oxidase polypeptide Va; mitochondrial cytochrome c oxidase subunit Va; cytochrome c oxidase polypeptide, mitochondrial;
Chromosome	15
Map Location	15q24.1
Summary	Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer of proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Va of the human mitochondrial respiratory chain enzyme. A pseudogene COX5AP1 has been found in chromosome 14q22. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for COX5A

Proteins

cytochrome c oxidase subunit 5A, mitochondrial precursor

Refseq ID:	NP_004246
Protein GI:	190885499
UniProt ID:	P20674
mRNA ID:	NM_004255
Length:	150
RefSeq Status:

`MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLN DFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV`

N
sig_peptide: 1..41
calculated_mol_wt: 4279
peptide sequence: 
MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCY

mat_peptide: 42..150
product: cytochrome c oxidase subunit 5A, mitochondrial
calculated_mol_wt: 12501
peptide sequence: 
SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGIST
PEELGLDKV