MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000783

Record overview

MITO ID	MT000783
Gene ID	10476
Species	Homo sapiens (Human)
Gene Name	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d
Gene Symbol	ATP5H
Synonyms	ATPQ;
Alternate names	ATP synthase subunit d, mitochondrial; My032 protein; ATPase subunit d; ATP synthase D chain, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1F0, subunit d; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d;
Chromosome	17
Map Location	17q25
Summary	Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq, Jun 2010]
Orthologs	View orthologs and multiple alignments for ATP5H

Proteins

ATP synthase subunit d, mitochondrial isoform a

Refseq ID:	NP_006347
Protein GI:	5453559
UniProt ID:	O75947
mRNA ID:	NM_006356
Length:	161
RefSeq Status:

ATP synthase subunit d, mitochondrial isoform b
`MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKS CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL`

Refseq ID:	NP_001003785
Protein GI:	51479152
UniProt ID:	O75947
mRNA ID:	NM_001003785
Length:	137
RefSeq Status:

`MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKVKSCAEWVSLSKARIVEYEKEMEKMKN LIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL`