MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000798

Record overview

MITO ID	MT000798
Gene ID	10632
Species	Homo sapiens (Human)
Gene Name	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G
Gene Symbol	ATP5L
Synonyms	ATP5JG;
Alternate names	ATP synthase subunit g, mitochondrial; ATPase subunit G; F1F0-type ATP synthase subunit g; ATP synthase g chain, mitochondrial; F1Fo-ATP synthase complex Fo membrane domain g subunit; ATP synthase, H+ transporting, mitochondrial F1F0, subunit g; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G;
Chromosome	11
Map Location	11q23.3
Summary	Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the g subunit of the Fo complex. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010]
Orthologs	View orthologs and multiple alignments for ATP5L

Proteins

ATP synthase subunit g, mitochondrial

Refseq ID:	NP_006467
Protein GI:	51479156
UniProt ID:	O75964
mRNA ID:	NM_006476
Length:	103
RefSeq Status:

`MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIG YDV`