MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000872

Record overview

MITO ID	MT000872
Gene ID	23192
Species	Homo sapiens (Human)
Gene Name	autophagy related 4B, cysteine peptidase
Gene Symbol	ATG4B
Synonyms	APG4B; AUTL1;
Alternate names	cysteine protease ATG4B; hAPG4B; autophagin-1; APG4 autophagy 4 homolog B; AUT-like 1 cysteine endopeptidase; ATG4 autophagy related 4 homolog B; autophagy-related protein 4 homolog B; autophagy-related cysteine endopeptidase 1;
Chromosome	2
Map Location	2q37.3
EC Number	3.4.22.-
Summary	Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for ATG4B

Proteins

cysteine protease ATG4B isoform a

Refseq ID:	NP_037457
Protein GI:	47132611
UniProt ID:	Q9Y4P1
mRNA ID:	NM_013325
Length:	393
RefSeq Status:

cysteine protease ATG4B isoform b
`MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQ RKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSD RHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFH CQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL`

Refseq ID:	NP_847896
Protein GI:	30410798
UniProt ID:	Q9Y4P1
mRNA ID:	NM_178326
Length:	380
RefSeq Status:

`MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQ RKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSD RHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFH CQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLGESCQVQILLM`