MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000896

Record overview

MITO IDMT000896
Gene ID23568
SpeciesHomo sapiens (Human)
Gene NameADP-ribosylation factor-like 2 binding protein
Gene SymbolARL2BP
SynonymsBART; RP66; BART1;
Alternate namesADP-ribosylation factor-like protein 2-binding protein; binder of Arl2; binder of Arl Two; ARL2-binding protein; binder of ARF2 protein 1; ARF-like 2-binding protein; Arf-like 2 binding protein BART1; retinitis pigmentosa 66 (autosomal recessive);
Chromosome16
Map Location16q13
SummaryADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for ARL2BP

Proteins

ADP-ribosylation factor-like protein 2-binding protein
Refseq ID:NP_036238
Protein GI:6912268
UniProt ID:Q9Y2Y0
mRNA ID:NM_012106
Length:163
RefSeq Status:
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHH
KDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH