MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000922

Record overview

MITO ID	MT000922
Gene ID	25932
Species	Homo sapiens (Human)
Gene Name	chloride intracellular channel 4
Gene Symbol	CLIC4
Synonyms	H1; huH1; p64H1; CLIC4L; MTCLIC;
Alternate names	chloride intracellular channel protein 4; chloride intracellular channel 4 like; intracellular chloride ion channel protein p64H1;
Chromosome	1
Map Location	1p36.11
Summary	Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for CLIC4

Proteins

chloride intracellular channel protein 4

Refseq ID:	NP_039234
Protein GI:	7330335
UniProt ID:	Q6FIC5
mRNA ID:	NM_013943
Length:	253
RefSeq Status:

`MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLC PPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKV VAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK`