MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001181

Record overview

MITO ID	MT001181
Gene ID	55847
Species	Homo sapiens (Human)
Gene Name	CDGSH iron sulfur domain 1
Gene Symbol	CISD1
Synonyms	ZCD1; MDS029; C10orf70; mitoNEET;
Alternate names	CDGSH iron-sulfur domain-containing protein 1; zinc finger CDGSH-type domain 1; zinc finger, CDGSH-type domain 1; CDGSH iron sulfur domain-containing protein 1;
Chromosome	10
Map Location	10q21.1
Summary	This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012]
Orthologs	View orthologs and multiple alignments for CISD1

Proteins

CDGSH iron-sulfur domain-containing protein 1

Refseq ID:	NP_060934
Protein GI:	8923930
UniProt ID:	Q9NZ45
mRNA ID:	NM_018464
Length:	108
RefSeq Status:

`MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGP LIIKKKET`