MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT001419

Record overview

MITO IDMT001419
Gene ID84701
SpeciesHomo sapiens (Human)
Gene Namecytochrome c oxidase subunit IV isoform 2 (lung)
Gene SymbolCOX4I2
SynonymsCOX4; COX4B; COX4-2; COX4L2; COXIV-2; dJ857M17.2;
Alternate namescytochrome c oxidase subunit 4 isoform 2, mitochondrial; COX IV-2; cytochrome c oxidase subunit IV-like 2;
Chromosome20
Map Location20q11.21
SummaryCytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for COX4I2

Proteins

cytochrome c oxidase subunit 4 isoform 2, mitochondrial
Refseq ID:NP_115998
Protein GI:17999526
UniProt ID:Q96KJ9
mRNA ID:NM_032609
Length:171
RefSeq Status:
MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSN
EWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK