MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001439

Record overview

MITO ID	MT001439
Gene ID	84987
Species	Homo sapiens (Human)
Gene Name	COX14 cytochrome c oxidase assembly factor
Gene Symbol	COX14
Synonyms	C12orf62;
Alternate names	cytochrome c oxidase assembly protein COX14; cytochrome c oxidase assembly homolog 14; COX14 cytochrome c oxidase assembly homolog;
Chromosome	12
Map Location	12q13.12
Summary	This gene encodes a small single-pass transmembrane protein that localizes to mitochondria. This protein may play a role in coordinating the early steps of cytochrome c oxidase (COX; also known as complex IV) subunit assembly and, in particular, the synthesis and assembly of the COX I subunit of the holoenzyme. Mutations in this gene have been associated with mitochondrial complex IV deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
Orthologs	View orthologs and multiple alignments for COX14

Proteins

cytochrome c oxidase assembly protein COX14

Refseq ID:	NP_116290
Protein GI:	14249670
UniProt ID:	Q96I36
mRNA ID:	NM_032901
Length:	57
RefSeq Status:

cytochrome c oxidase assembly protein COX14
`MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM`

Refseq ID:	NP_001244063
Protein GI:	380254499
UniProt ID:	Q96I36
mRNA ID:	NM_001257134
Length:	57
RefSeq Status:

cytochrome c oxidase assembly protein COX14
Protein sequence is identical to GI:14249670 (mRNA isoform)

Refseq ID:	NP_001244062
Protein GI:	380254497
UniProt ID:	Q96I36
mRNA ID:	NM_001257133
Length:	57
RefSeq Status:

Protein sequence is identical to GI:14249670 (mRNA isoform)