MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001462

Record overview

MITO ID	MT001462
Gene ID	91647
Species	Homo sapiens (Human)
Gene Name	ATP synthase mitochondrial F1 complex assembly factor 2
Gene Symbol	ATPAF2
Synonyms	ATP12; ATP12p; LP3663; MC5DN1;
Alternate names	ATP synthase mitochondrial F1 complex assembly factor 2; ATP12 homolog;
Chromosome	17
Map Location	17p11.2
Summary	This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. This gene is located within the Smith-Magenis syndrome region on chromosome 17. An alternatively spliced transcript variant has been described, but its biological validity has not been determined. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for ATPAF2

Proteins

ATP synthase mitochondrial F1 complex assembly factor 2

Refseq ID:	NP_663729
Protein GI:	21735485
UniProt ID:	Q8N5M1
mRNA ID:	NM_145691
Length:	289
RefSeq Status:

`MWRSCLRLRDGGRRLLNRPAGGPSASMSPGPTIPSPARAYAPPTERKRFYQNVSITQGEGGFEINLDHRKLKTPQAKLFTVPSEALAIAVATEWDSQQDT IKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVLVSHLASYN TWALQGIEFVAAQLKSMVLTLGLIDLRLTVEQAVLLSRLEEEYQIQKWGNIEWAHDYELQELRARTAAGTLFIHLCSESTTVKHKLLKE`