MitoProteome Database

MT001532

Record overview

MITO ID	MT001532
Gene ID	131118
Species	Homo sapiens (Human)
Gene Name	DnaJ (Hsp40) homolog, subfamily C, member 19
Gene Symbol	DNAJC19
Synonyms	PAM18; TIM14; TIMM14;
Alternate names	mitochondrial import inner membrane translocase subunit TIM14; homolog of yeast TIM14;
Chromosome	3
Map Location	3q26.33
Summary	The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012]
Orthologs	View orthologs and multiple alignments for DNAJC19

Proteins

mitochondrial import inner membrane translocase subunit TIM14 isoform 1

Refseq ID:	NP_660304
Protein GI:	21687102
UniProt ID:	Q96DA6
mRNA ID:	NM_145261
Length:	116
RefSeq Status:

`MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIA AKINEAKDLLEGQAKK`

N
transit_peptide: 1..18
inference: protein motif:SignalP:3.0
note: The cleavage site of the signal peptide has not been experimentally determined.
calculated_mol_wt: 1650
peptide sequence: 
MASTVVAVGLTIAAAGFA

mitochondrial import inner membrane translocase subunit TIM14 isoform 2

Refseq ID:	NP_001177162
Protein GI:	298231213
UniProt ID:	Q96DA6
mRNA ID:	NM_001190233
Length:	91
RefSeq Status:

`MKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK`