MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001533

Record overview

MITO ID	MT001533
Gene ID	131474
Species	Homo sapiens (Human)
Gene Name	coiled-coil-helix-coiled-coil-helix domain containing 4
Gene Symbol	CHCHD4
Synonyms	MIA40; TIMM40;
Alternate names	mitochondrial intermembrane space import and assembly protein 40; translocase of inner mitochondrial membrane 40 homolog; coiled-coil-helix-coiled-coil-helix domain-containing protein 4; mitochondrial intermembrane space import and assembly 40 homolog;
Chromosome	3
Map Location	3p25.1
Summary	CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008]
Orthologs	View orthologs and multiple alignments for CHCHD4

Proteins

mitochondrial intermembrane space import and assembly protein 40 isoform 1

Refseq ID:	NP_001091972
Protein GI:	148612859
UniProt ID:	Q8N4Q1
mRNA ID:	NM_001098502
Length:	142
RefSeq Status:

mitochondrial intermembrane space import and assembly protein 40 isoform 2
`MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQK YPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS`

Refseq ID:	NP_653237
Protein GI:	21389469
UniProt ID:	Q8N4Q1
mRNA ID:	NM_144636
Length:	155
RefSeq Status:

`MPVSYSSVTTRYYHRAGAEEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDC VDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS`