MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001653

Record overview

MITO ID	MT001653
Gene ID	387715
Species	Homo sapiens (Human)
Gene Name	age-related maculopathy susceptibility 2
Gene Symbol	ARMS2
Synonyms	ARMD8;
Alternate names	age-related maculopathy susceptibility protein 2;
Chromosome	10
Map Location	10q26.13
Summary	This gene encodes a protein that is thought to play a role in diseases in the elderly. Mutations in this gene have been associated with age-related macular degeneration. [provided by RefSeq, Oct 2008]
Orthologs	View orthologs and multiple alignments for ARMS2

Proteins

age-related maculopathy susceptibility protein 2

Refseq ID:	NP_001093137
Protein GI:	153792797
UniProt ID:	P0C7Q2
mRNA ID:	NM_001099667
Length:	107
RefSeq Status:

`MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLS IIHTAAR`