MitoProteome Database

MT001663

Record overview

MITO ID	MT001663
Gene ID	400916
Species	Homo sapiens (Human)
Gene Name	coiled-coil-helix-coiled-coil-helix domain containing 10
Gene Symbol	CHCHD10
Synonyms	FTDALS2; N27C7-4; C22orf16;
Alternate names	coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial;
Chromosome	22
Map Location	22q11.23
Summary	This gene encodes a mitochondrial protein that is enriched at cristae junctions in the intermembrane space. It may play a role in cristae morphology maintenance or oxidative phosphorylation. Mutations in this gene cause frontotemporal dementia and/or amyotrophic lateral sclerosis-2. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7 and 19. [provided by RefSeq, Aug 2014]
Orthologs	View orthologs and multiple alignments for CHCHD10

Proteins

coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial isoform a

Refseq ID:	NP_001288268
Protein GI:	671744006
UniProt ID:	Q8WYQ3
mRNA ID:	NM_001301339
Length:	149
RefSeq Status:

coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial isoform b precursor
`MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQPLALYPQAPTPAA PQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP`

Refseq ID:	NP_998885
Protein GI:	47497976
UniProt ID:	Q8WYQ3
mRNA ID:	NM_213720
Length:	142
RefSeq Status:

`MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMG PCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP`

N
transit_peptide: 1..16
inference: non-experimental evidence, no additional details recorded
note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q8WYQ3.1)
calculated_mol_wt: 1684
peptide sequence: 
MPRGSRSAASRPASRP

mat_peptide: 17..142
product: Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (Q8WYQ3.1)
calculated_mol_wt: 12483
peptide sequence: 
AAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQ
SDLSLCEGFSEALKQCKYYHGLSSLP