MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001669

Record overview

MITO ID	MT001669
Gene ID	414899
Species	Homo sapiens (Human)
Gene Name	BH3-like motif containing, cell death inducer
Gene Symbol	BLID
Synonyms	BRCC2;
Alternate names	BH3-like motif-containing cell death inducer; breast cancer cell 2; breast cancer cell protein 2;
Chromosome	11
Map Location	11q24.1
Summary	This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion. [provided by RefSeq, Aug 2011]
Orthologs	View orthologs and multiple alignments for BLID

Proteins

BH3-like motif-containing cell death inducer

Refseq ID:	NP_001001786
Protein GI:	221316605
UniProt ID:	Q8IZY5
mRNA ID:	NM_001001786
Length:	108
RefSeq Status:

`MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLL CNSSAEAL`