MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001678

Record overview

MITO ID	MT001678
Gene ID	493856
Species	Homo sapiens (Human)
Gene Name	CDGSH iron sulfur domain 2
Gene Symbol	CISD2
Synonyms	ERIS; WFS2; ZCD2; NAF-1; Miner1;
Alternate names	CDGSH iron-sulfur domain-containing protein 2; mitoNEET-related 1 protein; zinc finger, CDGSH-type domain 2; nutrient-deprivation autophagy factor-1; endoplasmic reticulum intermembrane small protein;
Chromosome	4
Map Location	4q24
Summary	The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2. [provided by RefSeq, Mar 2011]
Orthologs	View orthologs and multiple alignments for CISD2

Proteins

CDGSH iron-sulfur domain-containing protein 2

Refseq ID:	NP_001008389
Protein GI:	56605994
UniProt ID:	Q8N5K1
mRNA ID:	NM_001008388
Length:	135
RefSeq Status:

`MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCR CWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV`