MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT001696

Record overview

MITO ID	MT001696
Gene ID	100272147
Species	Homo sapiens (Human)
Gene Name	C-x(9)-C motif containing 4
Gene Symbol	CMC4
Synonyms	p8; C6.1B; MTCP1; MTCP1B; MTCP1NB; p8MTCP1;
Alternate names	cx9C motif-containing protein 4; MTCP-1 type A; protein p8 MTCP-1; C-x(9)-C motif containing 4 homolog; mature T-cell proliferation-1 type A; mature T-cell proliferation 1, isoform p8; mature T-cell proliferation 1 neighbor protein;
Chromosome	X
Map Location	Xq28
Summary	This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.[provided by RefSeq, Mar 2009]
Orthologs	View orthologs and multiple alignments for CMC4

Proteins

cx9C motif-containing protein 4

Refseq ID:	NP_001018024
Protein GI:	66346713
UniProt ID:	P56277
mRNA ID:	NM_001018024
Length:	68
RefSeq Status:

`MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK`