MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000020

Record overview

MITO IDMT000020
Gene ID205
SpeciesHomo sapiens (Human)
Gene Nameadenylate kinase 4
Gene SymbolAK4
SynonymsAK3; AK 4; AK3L1; AK3L2;
Alternate namesadenylate kinase 4, mitochondrial; AK4; AK 4; adenylate kinase 3-like 1; ATP-AMP transphosphorylase; mitochondrial adenylate kinase-3; nucleoside-triphosphate-adenylate kinase; adenylate kinase isoenzyme 4, mitochondrial; GTP:AMP phosphotransferase AK4, mitochondrial;
Chromosome1
Map Location1p31.3
EC Number2.7.4.10
SummaryThis gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for AK4

Proteins

adenylate kinase 4, mitochondrial
Refseq ID:NP_982289
Protein GI:53832001
UniProt ID:P27144
mRNA ID:NM_203464
Length:223
RefSeq Status:
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEAL
DKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETN
KIWPYVYTLFSNKITPIQSKEAY
 
adenylate kinase 4, mitochondrial
Refseq ID:NP_037542
Protein GI:8051579
UniProt ID:P27144
mRNA ID:NM_013410
Length:223
RefSeq Status:
Protein sequence is identical to GI:53832001 (mRNA isoform)
 
adenylate kinase 4, mitochondrial
Refseq ID:NP_001005353
Protein GI:53832003
UniProt ID:P27144
mRNA ID:NM_001005353
Length:223
RefSeq Status:
Protein sequence is identical to GI:53832001 (mRNA isoform)