MitoProteome Database

MT000058

Record overview

MITO ID	MT000058
Gene ID	518
Species	Homo sapiens (Human)
Gene Name	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9)
Gene Symbol	ATP5G3
Synonyms	P3;
Alternate names	ATP synthase F(0) complex subunit C3, mitochondrial; ATPase protein 9; ATPase subunit C; ATP synthase subunit 9; ATP synthase proteolipid P3; ATP synthase, mitochondrial, C subunit-3; ATP synthase lipid-binding protein, mitochondrial; ATP synthase proton-transporting mitochondrial F(0) complex subunit C3; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9);
Chromosome	2
Map Location	2q31.1
Summary	This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding different proteins have been identified. [provided by RefSeq, Jun 2010]
Orthologs	View orthologs and multiple alignments for ATP5G3

Proteins

ATP synthase F(0) complex subunit C3, mitochondrial isoform A precursor

Refseq ID:	NP_001680
Protein GI:	4502301
UniProt ID:	P48201
mRNA ID:	NM_001689
Length:	142
RefSeq Status:

`MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLI IGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM`

N
transit_peptide: 1..67
calculated_mol_wt: 7103
peptide sequence: 
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISR

mat_peptide: 68..142
product: ATP synthase F(0) complex subunit C3, mitochondrial isoform A
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

transit_peptide: 1..67
calculated_mol_wt: 7103
peptide sequence: 
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISR

mat_peptide: 68..105
product: ATP synthase F(0) complex subunit C3, mitochondrial isoform B
calculated_mol_wt: 3526
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYAR

transit_peptide: 1..67
calculated_mol_wt: 7103
peptide sequence: 
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISR

mat_peptide: 68..142
product: ATP synthase F(0) complex subunit C3, mitochondrial isoform A
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

ATP synthase F(0) complex subunit C3, mitochondrial isoform A precursor

Refseq ID:	NP_001002258
Protein GI:	50659074
UniProt ID:	P48201
mRNA ID:	NM_001002258
Length:	142
RefSeq Status:

Protein sequence is identical to GI:4502301 (mRNA isoform)

N
transit_peptide: 1..67
calculated_mol_wt: 7103
peptide sequence: 
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISR

mat_peptide: 68..142
product: ATP synthase F(0) complex subunit C3, mitochondrial isoform A
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

ATP synthase F(0) complex subunit C3, mitochondrial isoform B precursor

Refseq ID:	NP_001177258
Protein GI:	298358756
UniProt ID:
mRNA ID:	NM_001190329
Length:	105
RefSeq Status:

`MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLI IGYAR`

N
transit_peptide: 1..67
calculated_mol_wt: 7103
peptide sequence: 
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISR

mat_peptide: 68..142
product: ATP synthase F(0) complex subunit C3, mitochondrial isoform A
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

transit_peptide: 1..67
calculated_mol_wt: 7103
peptide sequence: 
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISR

mat_peptide: 68..105
product: ATP synthase F(0) complex subunit C3, mitochondrial isoform B
calculated_mol_wt: 3526
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYAR