MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000061

Record overview

MITO IDMT000061
Gene ID523
SpeciesHomo sapiens (Human)
Gene NameATPase, H+ transporting, lysosomal 70kDa, V1 subunit A
Gene SymbolATP6V1A
SynonymsHO68; VA68; VPP2; Vma1; ATP6A1; ATP6V1A1;
Alternate namesV-type proton ATPase catalytic subunit A; V-ATPase subunit A; V-ATPase A subunit 1; V-ATPase 69 kDa subunit 1; vacuolar ATPase isoform VA68; vacuolar proton pump subunit alpha; vacuolar proton pump alpha subunit 1; ATPase, H+ transporting, lysosomal, subunit A1; H(+)-transporting two-sector ATPase, subunit A; H+-transporting ATPase chain A, vacuolar (VA68 type); vacuolar ATP synthase catalytic subunit A, ubiquitous isoform;
Chromosome3
Map Location3q13.31
EC Number3.6.3.14
SummaryThis gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for ATP6V1A

Proteins

V-type proton ATPase catalytic subunit A
Refseq ID:NP_001681
Protein GI:19913424
UniProt ID:P38606
mRNA ID:NM_001690
Length:617
RefSeq Status:
MDFSKLPKILDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFD
GIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWDFTPCKNLRVGSHITGGDIYGIVSENSLIKHKIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGVK
EKFTMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDG
KVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPER
EGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKAS
LAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSD
YAQLLEDMQNAFRSLED