MitoProteome Database

MT000067

Record overview

MITO ID	MT000067
Gene ID	551
Species	Homo sapiens (Human)
Gene Name	arginine vasopressin
Gene Symbol	AVP
Synonyms	VP; ADH; ARVP; AVRP; AVP-NPII;
Alternate names	vasopressin-neurophysin 2-copeptin; neurohypophyseal; prepro-AVP-NP II; antidiuretic hormone; vasopressin-neurophysin II-copeptin; prepro-arginine-vasopressin-neurophysin II;
Chromosome	20
Map Location	20p13
Summary	This gene encodes a precursor protein consisting of arginine vasopressin and two associated proteins, neurophysin 2 and a glycopeptide, copeptin. Arginine vasopressin is a posterior pituitary hormone which is synthesized in the supraoptic nucleus and paraventricular nucleus of the hypothalamus. Along with its carrier protein, neurophysin 2, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis where it is either stored or secreted into the bloodstream. The precursor is thought to be activated while it is being transported along the axon to the posterior pituitary. Arginine vasopressin acts as a growth factor by enhancing pH regulation through acid-base transport systems. It has a direct antidiuretic action on the kidney, and also causes vasoconstriction of the peripheral vessels. This hormone can contract smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. Mutations in this gene cause autosomal dominant neurohypophyseal diabetes insipidus (ADNDI). [provided by RefSeq, Mar 2010]
Orthologs	View orthologs and multiple alignments for AVP

Proteins

vasopressin-neurophysin 2-copeptin preproprotein

Refseq ID:	NP_000481
Protein GI:	13259533
UniProt ID:	P01185
mRNA ID:	NM_000490
Length:	164
RefSeq Status:

`MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAA FGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY`

N
sig_peptide: 1..19
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 1985
peptide sequence: 
MPDTMLPACFLGLLAFSSA

mat_peptide: 20..28
product: arginine vasopressin
calculated_mol_wt: 1087
peptide sequence: 
CYFQNCPRG

mat_peptide: 32..124
product: neurophysin 2
calculated_mol_wt: 9787
peptide sequence: 
AMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA

mat_peptide: 126..164
product: copeptin
calculated_mol_wt: 4021
peptide sequence: 
ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY