MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000068

Record overview

MITO IDMT000068
Gene ID572
SpeciesHomo sapiens (Human)
Gene NameBCL2-associated agonist of cell death
Gene SymbolBAD
SynonymsBBC2; BCL2L8;
Alternate namesbcl2-associated agonist of cell death; bcl2-L-8; BCL2-binding protein; bcl-2-like protein 8; BCL2-binding component 6; bcl-2-binding component 6; BCL-X/BCL-2 binding protein; bcl2 antagonist of cell death; BCL2-antagonist of cell death protein; bcl-XL/Bcl-2-associated death promoter;
Chromosome11
Map Location11q13.1
SummaryThe protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for BAD

Proteins

bcl2-associated agonist of cell death
Refseq ID:NP_004313
Protein GI:10835069
UniProt ID:Q92934
mRNA ID:NM_004322
Length:168
RefSeq Status:
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA
PPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
 
bcl2-associated agonist of cell death
Refseq ID:NP_116784
Protein GI:14670388
UniProt ID:Q92934
mRNA ID:NM_032989
Length:168
RefSeq Status:
Protein sequence is identical to GI:10835069 (mRNA isoform)