MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000077

Record overview

MITO ID	MT000077
Gene ID	597
Species	Homo sapiens (Human)
Gene Name	BCL2-related protein A1
Gene Symbol	BCL2A1
Synonyms	GRS; BFL1; ACC-1; ACC-2; HBPA1; BCL2L5;
Alternate names	bcl-2-related protein A1; bcl2-L-5; protein BFL-1; bcl-2-like protein 5; hematopoietic BCL2-related protein A1; hemopoietic-specific early response protein;
Chromosome	15
Map Location	15q24.3
Summary	This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and is up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for BCL2A1

Proteins

bcl-2-related protein A1 isoform 1

Refseq ID:	NP_004040
Protein GI:	4757840
UniProt ID:	Q16548
mRNA ID:	NM_004049
Length:	175
RefSeq Status:

bcl-2-related protein A1 isoform 2
`MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC`

Refseq ID:	NP_001108207
Protein GI:	168480072
UniProt ID:	Q16548
mRNA ID:	NM_001114735
Length:	163
RefSeq Status:

`MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPMLVESVAHKKRKMAL`