MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000085

Record overview

MITO ID	MT000085
Gene ID	638
Species	Homo sapiens (Human)
Gene Name	BCL2-interacting killer (apoptosis-inducing)
Gene Symbol	BIK
Synonyms	BP4; NBK; BIP1;
Alternate names	bcl-2-interacting killer; apoptosis inducer NBK; apoptosis-inducing NBK;
Chromosome	22
Map Location	22q13.31
Summary	The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins. [provided by RefSeq, Sep 2011]
Orthologs	View orthologs and multiple alignments for BIK

Proteins

bcl-2-interacting killer

Refseq ID:	NP_001188
Protein GI:	4502411
UniProt ID:	Q13323
mRNA ID:	NM_001197
Length:	160
RefSeq Status:

`MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDI RDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK`