MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000088

Record overview

MITO ID	MT000088
Gene ID	665
Species	Homo sapiens (Human)
Gene Name	BCL2/adenovirus E1B 19kDa interacting protein 3-like
Gene Symbol	BNIP3L
Synonyms	NIX; BNIP3a;
Alternate names	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; NIP3L; NIP3-like protein X; adenovirus E1B19k-binding protein B5; BCL2/adenovirus E1B 19-kd protein-interacting protein 3a; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A;
Chromosome	8
Map Location	8p21
Summary	This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. This protein counteracts the apoptotic inducer BNIP3 and may play a role in tumor suppression. [provided by RefSeq, Mar 2011]
Orthologs	View orthologs and multiple alignments for BNIP3L

Proteins

BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like

Refseq ID:	NP_004322
Protein GI:	4757860
UniProt ID:	O60238
mRNA ID:	NM_004331
Length:	219
RefSeq Status:

`MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQE DGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLA LGLGIYIGKRLSTPSASTY`