MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000114

Record overview

MITO IDMT000114
Gene ID1022
SpeciesHomo sapiens (Human)
Gene Namecyclin-dependent kinase 7
Gene SymbolCDK7
SynonymsCAK1; HCAK; MO15; STK1; CDKN7; p39MO15;
Alternate namescyclin-dependent kinase 7; CAK; p39 Mo15; protein kinase; 39 KDa protein kinase; kinase subunit of CAK; CDK-activating kinase 1; serine/threonine kinase stk1; cell division protein kinase 7; serine/threonine protein kinase 1; serine/threonine-protein kinase 1; serine/threonine protein kinase MO15; homolog of Xenopus MO15 Cdk-activating kinase; TFIIH basal transcription factor complex kinase subunit; cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase);
Chromosome5
Map Location5q12.1
EC Number2.7.11.22
SummaryThe protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for CDK7

Proteins

cyclin-dependent kinase 7
Refseq ID:NP_001790
Protein GI:4502743
UniProt ID:P50613
mRNA ID:NM_001799
Length:346
RefSeq Status:
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEV
IIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVG
CILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF