MitoProteome Database

MT000121

Record overview

MITO ID	MT000121
Gene ID	1173
Species	Homo sapiens (Human)
Gene Name	adaptor-related protein complex 2, mu 1 subunit
Gene Symbol	AP2M1
Synonyms	mu2; AP50; CLAPM1;
Alternate names	AP-2 complex subunit mu; adaptin-mu2; AP-2 mu chain; AP-2 mu 2 chain; HA2 50 kDA subunit; clathrin coat adaptor protein AP50; clathrin coat assembly protein AP50; clathrin coat-associated protein AP50; adaptor protein complex AP-2 subunit mu; clathrin adaptor complex AP2, mu subunit; plasma membrane adaptor AP-2 50kDA protein; plasma membrane adaptor AP-2 50 kDa protein; adapter-related protein complex 2 mu subunit; adapter-related protein complex 2 subunit mu; adaptor-related protein complex 2 subunit mu; clathrin assembly protein complex 2 medium chain; clathrin assembly protein complex 2 mu medium chain; clathrin-associated/assembly/adaptor protein, medium 1;
Chromosome	3
Map Location	3q28
Summary	This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for AP2M1

Proteins

AP-2 complex subunit mu isoform a

Refseq ID:	NP_004059
Protein GI:	14917109
UniProt ID:	Q96CW1
mRNA ID:	NM_004068
Length:	435
RefSeq Status:

MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEEN
IKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRV
VMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK
LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLK
VRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

AP-2 complex subunit mu isoform b

Refseq ID:	NP_001020376
Protein GI:	68799814
UniProt ID:	Q96CW1
mRNA ID:	NM_001025205
Length:	433
RefSeq Status:

MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEEN
IKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVM
KSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLE
VKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVR
YLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC