MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MT000129

Record overview

MITO IDMT000129
Gene ID1327
SpeciesHomo sapiens (Human)
Gene Namecytochrome c oxidase subunit IV isoform 1
Gene SymbolCOX4I1
SynonymsCOX4; COXIV; COX4-1;
Alternate namescytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX IV-1; cytochrome c oxidase polypeptide IV;
Chromosome16
Map Location16q24.1
SummaryCytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for COX4I1

Proteins

cytochrome c oxidase subunit 4 isoform 1, mitochondrial precursor
Refseq ID:NP_001852
Protein GI:4502981
UniProt ID:P13073
mRNA ID:NM_001861
Length:169
RefSeq Status:
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEW
KTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
 
N
transit_peptide: 1..22
experiment: experimental evidence, no additional details recorded
note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (P13073.1)
calculated_mol_wt: 2395
peptide sequence: 
MLATRVFSLVGKRAISTSVCVR

mat_peptide: 23..169
product: Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P13073.1)
calculated_mol_wt: 17200
peptide sequence: 
AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQK
HYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK