MitoProteome Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins

MT000142

Record overview

MITO ID	MT000142
Gene ID	1353
Species	Homo sapiens (Human)
Gene Name	COX11 cytochrome c oxidase copper chaperone
Gene Symbol	COX11
Synonyms	COX11P;
Alternate names	cytochrome c oxidase assembly protein COX11, mitochondrial; cytochrome c oxidase subunit 11; cytochrome c oxidase assembly homolog 11; COX11 cytochrome c oxidase assembly homolog; COX11 homolog, cytochrome c oxidase assembly protein;
Chromosome	17
Map Location	17q22
Summary	Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be a heme A biosynthetic enzyme involved in COX formation, according to the yeast mutant studies. However, the studies in Rhodobacter sphaeroides suggest that this gene is not required for heme A biosynthesis, but required for stable formation of the Cu(B) and magnesium centers of COX. This human protein is predicted to contain a transmembrane domain localized in the mitochondrial inner membrane. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene has been found on chromosome 6. [provided by RefSeq, Jun 2009]
Orthologs	View orthologs and multiple alignments for COX11

Proteins

cytochrome c oxidase assembly protein COX11, mitochondrial isoform 1

Refseq ID:	NP_004366
Protein GI:	4758034
UniProt ID:	Q9Y6N1
mRNA ID:	NM_004375
Length:	276
RefSeq Status:

cytochrome c oxidase assembly protein COX11, mitochondrial isoform 2
`MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVA AVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGIST YNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN`

Refseq ID:	NP_001156333
Protein GI:	242247057
UniProt ID:	B4DEY8
mRNA ID:	NM_001162861
Length:	230
RefSeq Status:

cytochrome c oxidase assembly protein COX11, mitochondrial isoform 3
`MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVA AVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGIST YNIVPFEAGQYFNKIQVLSSRLQSCTESTF`

Refseq ID:	NP_001156334
Protein GI:	242247061
UniProt ID:	B4DEY8
mRNA ID:	NM_001162862
Length:	231
RefSeq Status:

`MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVA AVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGIST YNIVPFEAGQYFNKIQASKLHRVYVLESWHL`